2_Th.ps_SELENOM_E

General Information

Protein ID
594 
External ID
 

Protein Information

Protein Name
2_Th.ps_SELENOM_E 
Family
SELENOM 
Species
Thalassiosira pseudonana 
Genome
 
EST
gi|162382429|gb|FC524311.1|FC524311,gi|162371798|gb|FC513297.1|FC513297,gi|162375565|gb|FC517326.1|FC517326,gi|162397157|gb|FC538635.1|FC538635 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGCTATCATCCGCCTCCCGCATACTCTTTCTCCTAGCAACCATCCTGGCCCTAACCACCGCCACCCTCCACGGAAGAATTGAATCCTGCTCTGGATGAAAATTGAACAAGCTTCCAGTTCTCAAATCCTTCCTAAAAGATGGAGAGGCAGAATCGTATAGAAACGTGGAGGTGAAGTATGTTCCTGGGAAACAGGCTGTATTGACGATTTATGAGGGTGAAGGGGAGGAGGTGGAGGGATGGGTGGAGAAAGAGAAGATTGTGTTGAGTGAACTCGAGACCAAGGAGGAGATGCATGCCTTGATGGTAGACAAAGGATTTGAACTGCGATCAGAAGAAGAAATAGCAGAACGCAAAGCGGAAAAGGAGAAAGAGGAGAAAGAACTGGCTGAAATGAGGAAGCGAAGACAAGCTGCATCGCAGGAAGCACGGCGCAAAAAGCAGAAGGAGCAGAGAGTGGACGATTTGAAAGACAAGGATGAGCTTTAG 
Protein Sequence
MLSSASRILFLLATILALTTATLHGRIESCSGUKLNKLPVLKSFLKDGEAESYRNVEVKYVPGKQAVLTIYEGEGEEVEGWVEKEKIVLSELETKEEMHALMVDKGFELRSEEEIAERKAEKEKEEKELAEMRKRRQAASQEARRKKQKEQRVDDLKDKDEL* 
SECIS Sequence
 

Structure Picture