2_Au.an_SELENOH_G

General Information

Protein ID
577 
External ID
 

Protein Information

Protein Name
2_Au.an_SELENOH_G 
Family
SELENOH 
Species
Aureococcus anophagefferens 
Genome
ACJI01001368 
EST
 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
CTCGACGCGCTCACGGTGCCGCAGCTCAAGGAGCTGCTGCGTGCCGGCGGTTTCAAGGTCGGCGGCCGCAAGGCCGAGCTCATCGACCGCATCCTCGCCGGCGGAGGCGCCGCGCCGGCCGTGCTCATCGCCGCGTGCAAGAGCTGACAGGCCTTCGCCCGCGCCGCGGTGCGGCTCCAGACCCTCGTGCTCGAGGAGTCGCCGGAGACGGCGATCTGGGGGCGCGGCGCGGCTTCGACCCGCCGCGCGCGCTCGAGGATAAGCCGGTCAAGGGCAAGTTCAAGGTGACCGTCGTCACCGCGAGCGGCGACGTCGTCGTCGCGGAGACGGGCCCGGAGCCGCGGCCGTTCCCGGACCTCAAGGCCCTGGACCTCCCGTCCATCGCCGAGGACGTGCTCGAC 
Protein Sequence
LDALTVPQLKELLRAGGFKVGGRKAELIDRILAGGGAAPAVLIAACKSUQAFARAAVRLXPRARGVAGDGDLGARRGFDPPRALEDKPVKGKFKVTVVTASGDVVVAETGPEPRPFPDLKALDLPSIAEDVLD 
SECIS Sequence
 

Structure Picture