3_Em.hu_SELENOH_Mg

General Information

Protein ID
572 
External ID
 

Protein Information

Protein Name
3_Em.hu_SELENOH_Mg 
Family
SELENOH 
Species
Emiliania huxleyi 
Genome
KB864456 
EST
gi|261438743|gb|FP199046.1|FP199046,gi|261428695|gb|FP229651.1|FP229651,gi|261436562|gb|FP163031.1|FP163031,gi|261424022|gb|FP171753.1|FP171753,gi|261421789|gb|FP183549.1|FP183549,gi|261451939|gb|FP202196.1|FP202196,gi|261426463|gb|FP196728.1|FP196728 
Functional Domain
 
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
CAACTGAGACGGCGGCTTCCAAGAGGCGGAGGCTGCCACCCGCTTCGTGAAGGCTGTCTTCCCGGACGCGCAGGTGGACGCTGTGCAGATTAGAAAACGCCCGATCCGCGTGACCATCTCCAGCGGCGGCCGTGAGCTCGTCCGCGTCGATCAACGAGACCTGTTCGGCAAATACGGCTGGCCGGCTGAGAAACCAATCACCGAGGCGCTGCTCAAGTTCAAGGCCGATGAGACGGCGGGCCCTACCGCTGCGGCCGTGGCTGCAGAGTAG 
Protein Sequence
NUDGGFQEAEAATRFVKAVFPDAQVDAVQIRKRPIRVTISSGGRELVRVDQRDLFGKYGWPAEKPITEALLKFKADETAGPTAAAVAAE* 
SECIS Sequence
NUDGGFQEAEAATRFVKAVFPDAQVDAVQIRKRPIRVTISSGGRELVRVDQRDLFGKYGWPAEKPITEAL 

Structure Picture