Em.hu-MSRA-1-U

General Information

Protein ID
569 
External ID
 

Protein Information

Protein Name
Em.hu-MSRA-1-U 
Family
MSRA 
Species
Emiliania huxleyi 
Genome
KB863010 
EST
gi|261430848|gb|FP208357.1|FP208357,gi|261440144|gb|FP199425.1|FP199425,gi|261433167|gb|FP207299.1|FP207299,gi|261429539|gb|FP205475.1|FP205475,gi|261426570|gb|FP196944.1|FP196944,gi|261454705|gb|FP203347.1|FP203347,gi|261422522|gb|FP167500.1|FP167500,gi|261448364|gb|FP220982.1|FP220982,gi|261437890|gb|FP177972.1|FP177972,gi|261437005|gb|FP188679.1|FP188679,gi|261452103|gb|FP224950.1|FP224950,gi|261421396|gb|FP171287.1|FP171287,gi|261422858|gb|FP194131.1|FP194131,gi|261424304|gb|FP184130.1|FP184130,gi|261435851|gb|FP187619.1|FP187619,gi|261427495|gb|FP173111.1|FP173111,gi|261453955|gb|FP214612.1|FP214612,gi|261429554|gb|FP205506.1|FP205506,gi|261450225|gb|FP210090.1|FP210090,gi|261426929|gb|FP169855.1|FP169855,gi|261423718|gb|FP195633.1|FP195633 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGCGATCCAGACCCGGCCGCGGCCGCGGGACTGGCCGCCGCCACCGAGACGGCCGTCATCGCGCTGGGGTGATTCTGGCATCCGCAGGCCGAGTACGACTCGCTTCCCGGCGTCGTCTCCACCTCGGTCGGCTATACGGGTGGTGCGTCCTCGAACCCCACGTACTCCACCGTCTGCCGCGGGGACGGGCACACAGAGGCTCTCAAGGTGGAGTACGACCCGACCAAGACTTCATACGAGGCGCTGATGACACGCTTCTTCGCCGAGGCGTCGGCCCACAAGAGCAAGCCGCAGTACATGAGCGCCGTGTGGGCGCAGAATGCGGAGCAAAGGGCGACCGCCGAGAGAATTGCGAGGCAGAGCGGCAAGCCCATCCCCGTGCTCGACGCAAAGCAGTGGCACGACGCTGAGGAGTATCATCAGCACTACATCGACAAGCAGTATGGAAGGAGGTGA 
Protein Sequence
CDPDPAAAAGLAAATETAVIALGUFWHPQAEYDSLPGVVSTSVGYTGGASSNPTYSTVCRGDGHTEALKVEYDPTKTSYEALMTRFFAEASAHKSKPQYMSAVWAQNAEQRATAERIARQSGKPIPVLDAKQWHDAEEYHQHYIDKQYGRR* 
SECIS Sequence
AGLAAATETAVIALGUFWHPQAEYDSLPGVVSTSVGYTGGASSNPTYSTVCRGDGHTEALKVEYDPTKTSYEALMTRFFAEASAHKSKPQYMSAVWAQNAEQRATAERIARQSGKPIPVLDAKQWHDAEEYHQHYIDKQYGRR 

Structure Picture