Ni.hy-MSRA-1-U

General Information

Protein ID
564 
External ID
 

Protein Information

Protein Name
Ni.hy-MSRA-1-U 
Family
MSRA 
Species
Nitella hyalina 
Genome
 
EST
gi|372592042|gb|HO566409.1|HO566409 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGAACGCTGACCCTCCCGGCGCGCAGCGCGCTATCTTCGCCACCGGCTGATTTTGGGGGCCGGATGCTTCTTTTGGAGGCATCAATGGTGTTGTCCGCACGCGCGTGGGTTACCACGGCGGGCAGCAGCCCAATCCCACCTACCACAATATGATGGATCACACCGAGAGCATTGAGGTGATCTTTGACCCGGCCAAGATTAGCTACGAGAAGCTTCTTGAGTTCTTCTGGAGCGAGCACAACCCTTTCCATAGCTCGTACTCGCGCCAGTACATGAACGCGGTGTGGTATAGCAACGACCAGCAGCGCGCTGCTATCGAAGCGAGCAAGCAGAAGGTCGCCACCAAGTCCTCCGAGCCGATCCGCACCACCGTCGCCCCTGCGGCGCGTTCACCGAGGCCGAGGGCTACCACCAGAAGTACTACCTGCAGGGCAAGCACAAGCTCGTCCAGGAGCTC 
Protein Sequence
MNADPPGAQRAIFATGUFWGPDASFGGINGVVRTRVGYHGGQQPNPTYHNMMDHTESIEVIFDPAKISYEKLLEFFWSEHNPFHSSYSRQYMNAVWYSNDQQRAAIEASKQKVATKSSEPIRTTVAPAXFTEAEGYHQKYYLQGKHKLVQEL 
SECIS Sequence
 

Structure Picture