1_Mi.co_SELENOH_Mg

General Information

Protein ID
539 
External ID
 

Protein Information

Protein Name
1_Mi.co_SELENOH_Mg 
Family
SELENOH 
Species
Micromonas commoda 
Genome
CP001328 
EST
gi|255080909|ref|XM_002503975.1| 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGGGTTGGTTTCCCTGGGACGACACCCCACCCGACGCGGGCGCCCCCGTGGACGAGGACACGTACGTGGTCACCTACTGCCGCAACTGAGACGGCGGGCAGCAGGAGTACAACGCGGCGCGCGACGCCATTCGCAAAGTGCACAAGCATGCGAAAGTCGTGCCCAACAGGATAGACTCCTACCCCATCCAGGTCAGCGTGACGAAGGGCGGCACCACGATATGGAGCGGACGACAACAGGCGCTGTTCGCTAAGAACGGCAGGCCAGCCCAGAAGGAGATCGTCGCCGCGCTTCAGAAGCGTTAA 
Protein Sequence
MGWFPWDDTPPDAGAPVDEDTYVVTYCRNUDGGQQEYNAARDAIRKVHKHAKVVPNRIDSYPIQVSVTKGGTTIWSGRQQALFAKNGRPAQKEIVAALQKR* 
SECIS Sequence
VTYCRNUDGGQQEYNAARDAIRKVHKHAKVVPNRIDSYPIQVSVTKGGTTIWSGRQQALFAKNGRPAQKEIVAALQ 

Structure Picture