8_Em.hu_SELENOM_E

General Information

Protein ID
527 
External ID
 

Protein Information

Protein Name
8_Em.hu_SELENOM_E 
Family
SELENOM 
Species
Emiliania huxleyi 
Genome
 
EST
gi|261425552|gb|FP172811.1|FP172811,gi|261449897|gb|FP166072.1|FP166072,gi|261439921|gb|FP188950.1|FP188950,gi|261449708|gb|FP165892.1|FP165892,gi|261455869|gb|FP233666.1|FP233666,gi|261445420|gb|FP179959.1|FP179959,gi|261449244|gb|FP190648.1|FP190648,gi|261442489|gb|FP200173.1|FP200173,gi|261449814|gb|FP190995.1|FP190995 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGCTCTCCGGCGCTGTGCTCACCTTGCTGGCCGCGTCGGCCGCGAAGAAGGCCGCGGGCGGTGGCGGGTGCGAGGTCACCTCGACGTGGCCGGATGGGCGCGTGGAGCAGCGTCAGTGCGTGGTGCAGGCCGTCTCGGACAGGCCCGGTGCACGCGGCCGCTTTGAGAGCTGCACGGCCTGAAAGCTGGACGAGGAGCACAACGCGAGGCTCCGGCGATACCTGAAGCAGGACGAGGGGTGGAAGGAGTGGGAGGGCCTGGAGATGCAGTGGATCAGGCACCACAACCCCGACCTGGTCGTCCTCGACGACAACGGGCGCGAAAAGGCGAGGGTCGACCTGAACGGCTACGATGGGCCGCGGGTGGAGGCGCTGCTCGAGAAGCACGGCTTCAAGCGCAAGTAA 
Protein Sequence
MLSGAVLTLLAASAAKKAAGGGGCEVTSTWPDGRVEQRQCVVQAVSDRPGARGRFESCTAUKLDEEHNARLRRYLKQDEGWKEWEGLEMQWIRHHNPDLVVLDDNGREKARVDLNGYDGPRVEALLEKHGFKRK* 
SECIS Sequence
 

Structure Picture