1_Rh.sa_SELENOH_E

General Information

Protein ID
519 
External ID
 

Protein Information

Protein Name
1_Rh.sa_SELENOH_E 
Family
SELENOH 
Species
Rhodomonas salina 
Genome
 
EST
gi|117417874|gb|EG750467.1|EG750467 
Functional Domain
 
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
GTGCAGTTCTGCGCCAACTGAGACGGAGGGCTGCAGGAGATGCGCGCAGCAGAGAGCGCAGTGCTCAGCGCGGACCCTGCAGCGCGGGTGGAGGCCAAGTGCGTGCGCGCGCACCCCTATCCGCATCACCGTCATCAAGCAGCGCCGCGATGCCTCTGCACAGAAAGTTCTCTTTGA 
Protein Sequence
VQFCANUDGGLQEMRAAESAVLSADPAARVEAKCVRAHPYPHHRHQAAPRCLCTESSL* 
SECIS Sequence
 

Structure Picture