Th.ps-SELENOM-2-U

General Information

Protein ID
503 
External ID
 

Protein Information

Protein Name
Th.ps-SELENOM-2-U 
Family
SELENOM 
Species
Thalassiosira pseudonana 
Genome
 
EST
gi|162385151|gb|FC526771.1|FC526771,gi|162391279|gb|FC532907.1|FC532907 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGATTCTGGTTAGAATATTTCCCCCGGTATTACTTTTCCTATCCATGCTTCTCGTTTGGAGTGATGCCCAAGAACAGCGACTCACAGGTCTCATTGAGTCATGCTCGGGATGAGCACTCAATAGGCTGCCTGAATTGAAATCGTTTCTTAAGGATCTGAATGGCGTAGATCTTTACAAGAATGTAGAGGTTCATTTCATAAGTGGCAAAAGGGCGGTGTTGACGATATTTGAGGGAGGAAGGGAGTTGGAGAAGATCACGTTGAGTGATTACAATGACAAGGAGAAGTTGCATACTTTGTTTGCAGAGAAGGGATTTGTGAAGTATACAGGCGTTGAACTGGCGGAGAGGAGAAAGGTGGAGGCAGAGGAAACTGGATCTCTGCAAAAAACGCTCGAGGCACAGCGATATTCTTTGAGCAAAAGAGAACAGAAACTACAAATGAAGGAGAGGCTGAAGAAACTACAAACAGCTAGAGACAACTACATGATAGAGGCTCCTTTCGTGGAGCAGTAG 
Protein Sequence
MILVRIFPPVLLFLSMLLVWSDAQEQRLTGLIESCSGUALNRLPELKSFLKDLNGVDLYKNVEVHFISGKRAVLTIFEGGRELEKITLSDYNDKEKLHTLFAEKGFVKYTGVELAERRKVEAEETGSLQKTLEAQRYSLSKREQKLQMKERLKKLQTARDNYMIEAPFVEQ* 
SECIS Sequence
 

Structure Picture