Ba.pr-SELENOM-1-U

General Information

Protein ID
497 
External ID
 

Protein Information

Protein Name
Ba.pr-SELENOM-1-U 
Family
SELENOM 
Species
Bathycoccus prasinos 
Genome
NC_023996 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
GCGAAATTCATCTCCTGCCCAGGGTGACGCTTAAACGCACATCCGGCGTTGAAAAAGCTTCTGAAACAGGACGTGGAGAAGCGCGTTCGATTCGGCGAGAAAGTTTCCGTGGAATGGCAAAACGGAAGCCCGATTTATCTCGAGTTTTTGGACGAAGACGGCGCGAAAGTGAACGATTTGAAACGAAACGTGGAACAGCTCTCGGTGGAGGAAATCAGCGATATCTTGGGAAAGTTTGGGTTTCACGACATAGAC 
Protein Sequence
AKFISCPGURLNAHPALKKLLKQDVEKRVRFGEKVSVEWQNGSPIYLEFLDEDGAKVNDLKRNVEQLSVEEISDILGKFGFHDID 
SECIS Sequence
 

Structure Picture