Vo.ca-MSRA-1-U

General Information

Protein ID
495 
External ID
 

Protein Information

Protein Name
Vo.ca-MSRA-1-U 
Family
MSRA 
Species
Volvox carteri 
Genome
GL378334 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGAGTGGCGCAGAACCGTCCGTGGAGGTCGCCACGTTTGCGCTTGGCTGATTCTGGCACCCGGAGGCTTCATTCGCGAAGCTTCCAGGCGTGGTTAAGACGCGTGTGGGCTACACTGGCGGCACCAGCCCCAACCCCACGTACGGCAGCGTATGCGCGGGCGATGGACACACGGAGGCTTTACGGATCTGGTACGACCCTTCGGTGGTGTCGTACGAGGAACTGCTAAAGATGTTCTTCCGCGACCACGACCCCACCCACCGTACCAAATGCCAGTACAAATCAGCCATCTGGTACCATAACGAGGTGCAGCGGCGGGCCGCAGCGGCCGCAATGTCAGAACTGGAATCCAAATTCCGAGTACGACTAGCTACCACCCTGGATCCCGCGGGACCCTGGTACGATGCCGAGGAGTACCACCAGAAATACATTGAGAAGTCCATGAGCCGACGTGGCAGCTGGGCAGCCTGG 
Protein Sequence
MSGAEPSVEVATFALGUFWHPEASFAKLPGVVKTRVGYTGGTSPNPTYGSVCAGDGHTEALRIWYDPSVVSYEELLKMFFRDHDPTHRTKCQYKSAIWYHNEVQRRAAAAAMSELESKFRVRLATTLDPAGPWYDAEEYHQKYIEKSMSRRGSWAAW 
SECIS Sequence
UGUAUAGGAAGGUGUGUCGGAAUAUGACGUGCGUGGCUUUGAAAGGGGAUGGCUUCUAAAGAGGCAUCUUGAGUGCGCACUGACGGGGAAAAGCUGACGACAACC 

Structure Picture