Em.hu-SELENOH-1-U

General Information

Protein ID
494 
External ID
 

Protein Information

Protein Name
Em.hu-SELENOH-1-U 
Family
SELENOH 
Species
Emiliania huxleyi 
Genome
KB868610 
EST
gi|261451645|gb|FP212199.1|FP212199,gi|261454445|gb|FP235073.1|FP235073,gi|261440069|gb|FP188571.1|FP188571,gi|261442189|gb|FP186074.1|FP186074 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGTGCGCCAGTGAAAACCTCGCCAGCTGCACCGTCGTGCAGCTCAAGGAGAAGCTGCGTAGCGCAGGCCTGCCCGTGTCGGGGCGCAAAGCCGACCTGATTGCTCGGCTGAGCCTTCCCGACGAGGCGGCAACAGCGCTTCAGCCAGCGCCGCCCGTCGATGCAGCTGTGCTCGCCTTTCCCGCGGTCGAGATTGAGGCATGCAAGCAATGATCTGTCTTCAAAACGCGGGCGAAAAAGATTGCCGGCGGGATTGAGGCAGCGCTCGATGGCACTGACACGCCGCTGCAAGTGAGCATCAACGCCGAACGTCCGCGCCGAGGTGTCTTTGAGGTCCGTGTTGGAGAGACGGTCATCGTCAGTACGGGCCCAGAGCCGCGGCCCTTCCCGGCGCTCAAGGCGCTCGACGTAGACGAGGTGACTGCGTCGGCCGTCGACACGGCCAAGGCTTACTTCCTGCTGGGCTAG 
Protein Sequence
MCASENLASCTVVQLKEKLRSAGLPVSGRKADLIARLSLPDEAATALQPAPPVDAAVLAFPAVEIEACKQUSVFKTRAKKIAGGIEAALDGTDTPLQVSINAERPRRGVFEVRVGETVIVSTGPEPRPFPALKALDVDEVTASAVDTAKAYFLLG* 
SECIS Sequence
SLPDEAATALQPAPPVDAAVLAFPAVEIEACKQUSVFKTRAKKIAGGIEAALDGTDTPLQVSINAERPRRGVFEVRVGETVIVSTGPEPRPFPALKALDVDEVTA 

Structure Picture