Em.hu-SELENOT-3-U

General Information

Protein ID
486 
External ID
 

Protein Information

Protein Name
Em.hu-SELENOT-3-U 
Family
SELENOT 
Species
Emiliania huxleyi 
Genome
KB864346 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
TTTTGCATGAGCTGAGGGTACAAGAAGGCGGCCGAGGACTATGGCCGCGCTCTGAAACGCGAATACCCGAACGTGCAGCTCAAGGGCGACGTGCATCACCCGGGCGACCTCCGCGTCGGGCTGGCGCAGGTGCTGCAGCTCGGCTTCTTTGGCGGCCTCATGCTCTCGTTCGTGGGCAAGAGCTTCCTCCCGGAGCAGATTGCAAACACAATGACGTCCAACCCGATGATGACATACGGCACGCTCTTCGGGATGAACATCGCTGCGGGCAAGCTCATCAACACGGGCGCCTTCGAGGTGACCTACGCCGCCGCGCCCGGCGCCGCGCCCGAGCCGTGCTGGTCTAAGCTTGAGACAGGCCGCTTCCCCTCCCTGGAGGAGCTC 
Protein Sequence
FCMSUGYKKAAEDYGRALKREYPNVQLKGDVHHPGDLRVGLAQVLQLGFFGGLMLSFVGKSFLPEQIANTMTSNPMMTYGTLFGMNIAAGKLINTGAFEVTYAAAPGAAPEPCWSKLETGRFPSLEEL 
SECIS Sequence
UUAGCGCCGCACCCGCCCGCUCCGGCGUCUAUGACUGUCGUCGCUCGGAAACAGGGGCCCUCUCCCUGUGAGCACGACCGAUGCCCUGCCGGGGCGGAGGGUG 

Structure Picture