Ch.gl-SELENOH-1-U

General Information

Protein ID
481 
External ID
 

Protein Information

Protein Name
Ch.gl-SELENOH-1-U 
Family
SELENOH 
Species
Chaetosphaeridium globosum 
Genome
 
EST
gi|372698082|gb|HO375116.1|HO375116,gi|372658810|gb|HO400909.1|HO400909 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
TGAGGAGCATTTAAGACGCGGGCTACTAAGTTGGAGAAGTTACTGAAGGAGAAAGTGAGCGGTATTGAAATTGCAGTCAACGCTGAGAAGCCACGGAAGGGCTGTTTTGAAGTGCGAGATTCTCAAGGCACANTTTTGGTCTCCNTTCTGGACATGCCCCGGCCTTTCACGAAGCTCAAGGCCTTGGACATAGAGGAGCTTGCTGCAAGCATTGCGGCAGCAGTGGGGGGGGCTTGA 
Protein Sequence
UGAFKTRATKLEKLLKEKVSGIEIAVNAEKPRKGCFEVRDSQGTXLVSXLDMPRPFTKLKALDIEELAASIAAAVGGA* 
SECIS Sequence
GGUCUACACCAUUCAGAUGCCGGGCGGAUGACCAAUAACAGGCAAAGGGCAACCUCUGUUGUUGCGAGAACAGCCUUGCUCUUGGGGGACGCAUUA 

Structure Picture