Me.vi-SELENOM-1-U

General Information

Protein ID
475 
External ID
 

Protein Information

Protein Name
Me.vi-SELENOM-1-U 
Family
SELENOM 
Species
Mesostigma viride 
Genome
 
EST
gi|60429029|gb|DN260419.1|DN260419,gi|60428396|gb|DN259786.1|DN259786,gi|60428397|gb|DN259787.1|DN259787 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGTTGCCGGCGCCTCGGTACGCCCTTTTGGCGTCGCTCTTGCTGTGCTCTATTTACCTGCTGCCTTCCATTTATGGAAAAGAATTTGAAACTGCCGTGTTCGAGTCGTGCAGTGGATGACGATTGAATAAGCTACCTCAGGTGAAGTCTTTCTTCAAGAAAGAGGTAGAGAAAGGGCATTTTGGTCCGCATGTGACGGTTAAGTACATTCCGGGAAGGAATCCCGACCTTGTTTTGAAAGACAGCGAGGGTCAAGAGAAGGCCCGGATGGATATCTCCAAGATGACTTCGGCGGAGATTGGAGCGTTGCTGGAAATGAAAGGCTTTCCTCGTGTGAATGCCGAGGAGCTCTAA 
Protein Sequence
MLPAPRYALLASLLLCSIYLLPSIYGKEFETAVFESCSGURLNKLPQVKSFFKKEVEKGHFGPHVTVKYIPGRNPDLVLKDSEGQEKARMDISKMTSAEIGALLEMKGFPRVNAEEL* 
SECIS Sequence
GCAGCUGAAAACAUAGGGGCCUGCCAUGAAAUCGCCUUCCUAAAUUUUCAGAAGAAAAAGGGAGGCGUUUGAGAUUUUUUGGCCCCCACGUGA 

Structure Picture