Pa.lu-MSRA-1-U

General Information

Protein ID
466 
External ID
 

Protein Information

Protein Name
Pa.lu-MSRA-1-U 
Family
MSRA 
Species
Pavlova lutheri 
Genome
 
EST
gi|106855700|gb|EC174077.1|EC174077,gi|106859216|gb|EC177593.1|EC177593 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
CAGACCGCGACGCTGGCGCTCGGCTGATTCTGGCACCCGCAGGCGGCGTACGACGCGCTGCCTGGCGTGCGCGACACGGTCGTCGGCTACACGGGCGGCGTGAGCGAGTGGCCGACTTACGACGCAATCGGCGATCATACGGAGGCGTTGCGCGTCACGTTTGACCCCGAGCTCACCTCCTTTGAGCGGCTGGTCGACTTCTTTTTCGCCGAGCACTCGCCGATGCCGATGGCCTTCACAGGCGCTCAGTACCGCTCCGCCATCTTCTGGCACACGGAGGAGCAGCGGCTCGTCGCCGAGCGGCTCCGCGCGGAGATCCGCCCGTCGGATTTCCAAGCACACGGCCATTCTGCCGGCCGCCCCTTTCTTCCGCGCGGAGGAGTACCACCGAGAAATGGCTGTCGAAGCAGCTCGCGCGCTCGCGCGCCTAGCCGTATGCCTCCCCGTCGGCGAGCCGCGTGTGCGGCCGCGGGGCGCGGCTTCGACTCGATCGCGCCACATGACGGTGCTGCACCCAAAGCTCGCGCCCGTCCGAGCCGGTGCGCCACCCGAGAATCTGCGCGTCCGTCCTTGCACCGCCACTGCCAATCGGCGCCGCCACTGCCAATCAAATTCGGGACAATCATGA 
Protein Sequence
QTATLALGUFWHPQAAYDALPGVRDTVVGYTGGVSEWPTYDAIGDHTEALRVTFDPELTSFERLVDFFFAEHSPMPMAFTGAQYRSAIFWHTEEQRLVAERLRAEIXRRISKHTAILPAAPFFRAEEYHREMAVEAARALARLAVCLPVGEPRVRPRGAASTRSRHMTVLHPKLAPVRAGAPPENLRVRPCTATANRRRHCQSNSGQS* 
SECIS Sequence
GGGCGCGGCUUCGACUCGAUCGCGCCACAUGACGGUGCUGCACCCAAAGCUCGCGCCCGUCCGAGCCGGUGCGCCACCCGAGAAUCUGCGCGUCCGUCCUUGCACC 

Structure Picture