1_Ka.br_SELENOM_E

General Information

Protein ID
463 
External ID
 

Protein Information

Protein Name
1_Ka.br_SELENOM_E 
Family
SELENOM 
Species
Karenia brevis 
Genome
 
EST
gi|159023623|gb|EX979545.1|EX979545 
Functional Domain
 
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGGCGCTTGTTGCAGTTGTGCTCCTCGGCGTTGTTGCTGCAGCTGAGCCCAACCCTGCCGCCTCAAAGGCGAGCTTTGACACAAACACCACAAGGTGGCAGGGCCGGTGTGGGCGTATCATCTCCTGTCCTGGCTGAAGGCTGAATGGCTTACCTGAAGTTAAGAAGTTTCTCAAAGGACCTGATGGTGCGAAGCTGTACCCAGCAGTGGAGATCTCTTGGGTTCGAGGCAAAGACCCAGAGCTGCAGGTCTACGACTGCGCCGGCAAGCCACCGCCCGGCAAGCCGGAGACGGCTGCCTCGGAGCCGTTGGAGTCTCTGAGCCTCTCGCCGTACACGCACGAGCAGCTGCACTGGCTGCTGCAGTGCCATGGCCTTTCACATCCCAAGACCTCCAATGACACTGCTGAGATGCCTGGGTTGCTCTCAACTGAGAAAGCCTGCAGTGCTTTGGCTGCCGTTGACAGCAGCAGGTGGTGGTGGTTCGTCACAACGGCTCTGGGAGTTGCAGCAATCCTTCTCGTGGTGATTTGGTGTATATGCGGATTGCCCTCATTGCGTCCGTTGTTGAATGGAAAGAAGAAGAAGTGCGAGGATGATGCAAGCTCGCACGCTGAGCTCGAGATGACATGA 
Protein Sequence
MALVAVVLLGVVAAAEPNPAASKASFDTNTTRWQGRCGRIISCPGURLNGLPEVKKFLKGPDGAKLYPAVEISWVRGKDPELQVYDCAGKPPPGKPETAASEPLESLSLSPYTHEQLHWLLQCHGLSHPKTSNDTAEMPGLLSTEKACSALAAVDSSRWWWFVTTALGVAAILLVVIWCICGLPSLRPLLNGKKKKCEDDASSHAELEMT* 
SECIS Sequence
 

Structure Picture