Sa.ja-SELENOT-1-U

General Information

Protein ID
461 
External ID
 

Protein Information

Protein Name
Sa.ja-SELENOT-1-U 
Family
SELENOT 
Species
Saccharina japonica 
Genome
JXRI01000364 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
CCGCAGGTGCTGGTCCAGTTCTGCGTGTCATGAGGCATGCGGAGGAACTTCGAAGAGCTTCGGTCGTTCCTCCACATGCACTACCCGGTCCTCCAAGAGACCGACAGCATCCAGGGAGAGCTGTACCCCGCGCCCCCGTTCGCGCAGACGCTGGCCACGGTGGGTTCCTTCCTGCAGATGGGCGGCATCGCCGTTACCTTGGGGGGCTCGCTCATCTTCGACAGGCTGGGCGTGCCCGAACCGTTTTTCGTCCCCGTGATGCGGAACAACCCGATGCCGACTGTGATTGGTCTGTCCGTCGTGAACTTCATCTGCAGCTCCTTCACGTCGACGGGCGCGTTTGAGGTGTCCATCGATGGAGAGGTGGTGTTCTCTCGTTTGGAACAGCCGGGAAGGTTCCCGTCAGGCCCGGCGCTGTTGAAAGAGCTAGAG 
Protein Sequence
PQVLVQFCVSUGMRRNFEELRSFLHMHYPVLQETDSIQGELYPAPPFAQTLATVGSFLQMGGIAVTLGGSLIFDRLGVPEPFFVPVMRNNPMPTVIGLSVVNFICSSFTSTGAFEVSIDGEVVFSRLEQPGRFPSGPALLKELE 
SECIS Sequence
UAAAAAAAGCUCGACAGACUUUGAGCGUGAUGACGGUCGACAUAUACAAAGGCGUUGAGGCGCCCUGUGUUGACCUGAGAAGCCAAAGAAUGCGGCUGGAUGUCU 

Structure Picture