3_Th.oc_SELENOH_Mg

General Information

Protein ID
459 
External ID
 

Protein Information

Protein Name
3_Th.oc_SELENOH_Mg 
Family
SELENOH 
Species
Thalassiosira oceanica 
Genome
AGNL01048766 
EST
gi|347463142|gb|JP297138.1| 
Functional Domain
 
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
TGCCGCAACTGAGACGGGGGGGGACAGGAGCGCGACACGGCCGTGGCAGCGGTCAGGTCCGTCTTCCCCTCGTCCACGGTGACGCCCAACTGCGTCAACTCGTACCCGATACGTGTGATCGTCGAGGCGGAGCTCGACGACGGCACCTTCGAGGAGGTCTGGCGGGGGGACCAGCGGAACCTGTTCAGCAAGTACGCGGCCAAGAGGAAACAGGCCATAGAGGAGATCGTCAGGGGCCTGGACCAGCTCAAGGCCAGGCTTTAG 
Protein Sequence
CRNUDGGGQERDTAVAAVRSVFPSSTVTPNCVNSYPIRVIVEAELDDGTFEEVWRGDQRNLFSKYAAKRKQAIEEIVRGLDQLKARL* 
SECIS Sequence
CRNUDGGGQERDTAVAAVRSVFPSSTVTPNCVNSYPIRVIVEAELDDGTFEEVWRGDQRNLFSKYAAKRKQAIEEIVRGL 

Structure Picture