Ph.tr-SELENOT-1-U

General Information

Protein ID
458 
External ID
 

Protein Information

Protein Name
Ph.tr-SELENOT-1-U 
Family
SELENOT 
Species
Phaeodactylum tricornutum 
Genome
CM000619 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
GTAAAGATTCTGTTCTGCAACGGGTGAGGTATGAAGAGGAACTTTTTGAATGTGCAAAAGTTCCTCGAAGACCAGTTTCCCGAATTACGGGGGCACATTACGGGGGCCAACTACCCCCCACCAGCGACAATCGAACTAGCGGCCAACCTCATGTCCGTCATACAGCTCATGGGTATTTTCTGGATCGTCGCGGGTGGAGAAAAAATCTTTCGGTTCCTGGGCTATCCTCAAAATCAACTGCCTAGTGTCTATCATACCATCAACCAGAATGCGATGCCGATTGGCATTTTCTTGTTTCTGATTCTGCCGCAGTGGATTGGACGATATACCCAAACGGGAGCTTTTGAAGTTTATCTAAATGACAAAGAGATCTTCAGTAAGCTTTCGAAGGGAGCTTTTCCGACCGCTGACGACCTGATTTCTTCTTTGGTCCAGGCAGGCTTG 
Protein Sequence
VKILFCNGUGMKRNFLNVQKFLEDQFPELRGHITGANYPPPATIELAANLMSVIQLMGIFWIVAGGEKIFRFLGYPQNQLPSVYHTINQNAMPIGIFLFLILPQWIGRYTQTGAFEVYLNDKEIFSKLSKGAFPTADDLISSLVQAGL 
SECIS Sequence
AAGGAGGUAAACAUGUAGGAAGGCGCGCUGUGAGCUUCCGUACUGGAAAGGAUACGUGUGCGGGGUAGAUUGAGGGUGAGGAUGCCCGGAAUC 

Structure Picture