2_Em.hu_SELENOH_Mg

General Information

Protein ID
456 
External ID
 

Protein Information

Protein Name
2_Em.hu_SELENOH_Mg 
Family
SELENOH 
Species
Emiliania huxleyi 
Genome
KB865106 
EST
 
Functional Domain
 
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGTCCTCTCAACAGTTTGACATCACGTTCTGCGCCAACTGAGACGGCGGCTTCCAAGAGGCGGAGGCTGCCACCCGCTTCGTGAAGGCTGTCTTCCCGGACGCGCAGGTGGACGCTGTGCAGATTAGAAAACGCCCGATCCGCGTGACCATCTCCAGCGGCGGCCGTGAGCTCGTCCGCGTCGATCAACGAGACCTGTTCGGCAAATACGGCTGGCCGGCTGAGAAACCAATCACCGAGGCGCTGCTCAAGTTCAAGGCCGATGAGACGGCGGGCCCTACCGCTGCGGCCGTGGCTGCAGAGTAG 
Protein Sequence
MSSQQFDITFCANUDGGFQEAEAATRFVKAVFPDAQVDAVQIRKRPIRVTISSGGRELVRVDQRDLFGKYGWPAEKPITEALLKFKADETAGPTAAAVAAE* 
SECIS Sequence
ITFCANUDGGFQEAEAATRFVKAVFPDAQVDAVQIRKRPIRVTISSGGRELVRVDQRDLFGKYGWPAEKPITEAL 

Structure Picture