Os.ta-MSRA-1-U

General Information

Protein ID
45 
External ID
 

Protein Information

Protein Name
Os.ta-MSRA-1-U 
Family
MSRA 
Species
Ostreococcus tauri 
Genome
CAID01000009 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGCGCGCGTCCGGTACCGTCGTCGCCGCGACGTCCTCGCGCGCCGTGAATCGCATGCGTGCGCAAACCACCGCGCGATCGAGCGCGAGCGCCTCGGGATCACTCGCGCGAACGCAAAGAGGGGACGGGTTTAAGATTCCTGAAGGGTGCGAGCTCGCCGTGTTCGCGAGTGGATGATTCTGGGGTCCCGACGCGACGTTCAGCGCCCTGAAGGGGGCTAAACACGTTCGCGTCGGATATACCGGCGGTGAGACCGACCTGCCGACGTACACCACGGTGTGCGCGGGATCGACGGGGCACACCGAGGCCTATTACGTCGCGTACTCGCCAGCGGAGACGTCGTACGACAAACTCTTGGATCAGTTCTGGGCCGAGCACTCGCCGACGTACATGTCCAAGTCGCAGTATAAGTCGGCGATCTGGGCGCAAACGCCGGAGCAGTACGAGAAGGCGGTCGCGAGCAAGGATGCGGCGGAGCGACGGGTCGGACGGACGATGTTTACGGACATTTACCCGCCAGAGGTCTCGTTAGACACCGCATGGTGGGACGCCGAGGAGTATCATCAAGGGTATTATCGTAAACCACGCGTTTCTAGATTCGGTTGG 
Protein Sequence
MRASGTVVAATSSRAVNRMRAQTTARSSASASGSLARTQRGDGFKIPEGCELAVFASGUFWGPDATFSALKGAKHVRVGYTGGETDLPTYTTVCAGSTGHTEAYYVAYSPAETSYDKLLDQFWAEHSPTYMSKSQYKSAIWAQTPEQYEKAVASKDAAERRVGRTMFTDIYPPEVSLDTAWWDAEEYHQGYYRKPRVSRFGW 
SECIS Sequence
UCUUAGAUGGGCGACGAGUAGCGCGCAAACGUGACGACGAUGUCGCAAAGGAUGUGGACGUUCCAGUCCUCGACGUCGUUCGAUUCAUCGCGCGCUUCGAUCG 

Structure Picture