Ph.tr-SELENOH-1-U

General Information

Protein ID
444 
External ID
 

Protein Information

Protein Name
Ph.tr-SELENOH-1-U 
Family
SELENOH 
Species
Phaeodactylum tricornutum 
Genome
CM000611 
EST
gi|187001955|gb|CU734001.1|CU734001 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGGTGCGTACAACTCGCAGTTCGGCTCGTTTAGCCGCAGCCCCGGCGAAAGAAGCTCCCGTTGCTGTCAAGAAGACGGTAATCAAGAAGGCTGCGCCCAAGAAAGACACCAAGAAAAGCGATCATCCCAAGGTCGTCGATGAGAAGGATCACCCTGCGGAATCTCCCGCCGCTCCCGCTACTTCGGCTGCCGAAGACACTGGCGATGAGAAGAAGACCGGGACCGACGATCAAAAGAAGACTGTAGCTATTGAGGCCTGCAAGCAATGAGGCGCTTTCAAGACACGGGCCAACACCATTGTCAAGGCTGTGGGGGACAAGGCCAAGATCTCAATCAATGCCGAAAAACCTGGCAAGGGGAATTTCGTCGTTCGCGTCAGTGGGCAAGATGCTCCATTGGTGGAACTTTTGGGTCTAAAGCGCCCATTCCCACCGTTGAAGGCTTTGGATATGGAGGAAGTATGTGAGAAAGTGCTCCAAGCGATTGAGGCATAA 
Protein Sequence
MVRTTRSSARLAAAPAKEAPVAVKKTVIKKAAPKKDTKKSDHPKVVDEKDHPAESPAAPATSAAEDTGDEKKTGTDDQKKTVAIEACKQUGAFKTRANTIVKAVGDKAKISINAEKPGKGNFVVRVSGQDAPLVELLGLKRPFPPLKALDMEEVCEKVLQAIEA* 
SECIS Sequence
VAIEACKQUGAFKTRANTIVKAVGDKAKISINAEKPGKGNFVVRVSGQDAPLVELLGLKRPFPPLKALDMEEVCEKVLQAIEA 

Structure Picture