1_Vo.ca_SELENOM_E

General Information

Protein ID
437 
External ID
 

Protein Information

Protein Name
1_Vo.ca_SELENOM_E 
Family
SELENOM 
Species
Volvox carteri 
Genome
 
EST
gi|167203866|gb|FD924417.1|FD924417,gi|167128612|gb|FD852979.1|FD852979,gi|167195629|gb|FD915717.1|FD915717,gi|167182701|gb|FD905598.1|FD905598,gi|167097424|gb|FD818475.1|FD818475,gi|167094650|gb|FD820353.1|FD820353,gi|167186947|gb|FD908912.1|FD908912,gi|167192863|gb|FD917890.1|FD917890 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGTTGCTTGCGCTGTTGTGCAGTAAGCTCACACCTTTAGCGCAAGGACAGGCAGGCAGGGTTGCAAAAGCAGAGTTTATCAGTTGCCCTGGCTGACGATTGAACCACCTGCCCGAGGTTAAGAGGTTTCTGAAAGGCGATATCGAGCAAGGTGCCTACGAAAACGTCGCCGTAAACTTCATTCCGGGCAGGATTCCAGAGCTGGTACTCTACGATTCAAATAATGTTGAGGTTGAGCGGATGTTCGTCGACAAGCTCAAGTATGATGAGCTCCACACACTTATCCAAACCAAAGGCTTTCATCGGAAAGTTCTCGGTGCCACAGCTGTCCGCTTGCGTACCTTCCGGAGGGTATTGTGGTGGCTGGTTTGA 
Protein Sequence
MLLALLCSKLTPLAQGQAGRVAKAEFISCPGURLNHLPEVKRFLKGDIEQGAYENVAVNFIPGRIPELVLYDSNNVEVERMFVDKLKYDELHTLIQTKGFHRKVLGATAVRLRTFRRVLWWLV* 
SECIS Sequence
 

Structure Picture