Os.lu-MSRA-1-U

General Information

Protein ID
43 
External ID
 

Protein Information

Protein Name
Os.lu-MSRA-1-U 
Family
MSRA 
Species
Ostreococcus lucimarinus 
Genome
CP000589 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGCGCGCTGCCGTCGCGACCGCGCGCGTCGCCGCTCCCTCGCGCGCGTCCGCGAACAAAAGAAACGTCCGCGCGCTCGCCGCGATGCCCGCGAGCAAGGACGCGCGGCGCACCGACCGCGGCGATGGTTTCGTCGTCCCGGAAAATTGCCAACTCGCCGTCTTCGCCTCTGGGTGATTTTGGGGGCCCGACGCCTCGTTCAGCGCGCTCAAGGGCGTGAAGAACGTCAGGGTCGGGTACACAGGAGGCGAGAGCGATTTCCCGACGTATTCAGCGGTGTGTGCCGGAGGAACCGGGCACACGGAGGGGTATTACGTGGCGTACGACGCGGCGACGACGAGCTTCGATAAGCTGTTGGAACAGTTTTGGAGCGAGCATCAACCCACGTACGAAAGCAAAGCGCAGTATAAGAGCGCTATTTGGGCGCAGACGCCCGAGCAGTACGAAAAAGCGGTGGCGTCCAAGGAAGCGCGCGAGAAGCAAGTGCAGCGAAAGTTCTTCACCGATATCTACCCGCCGGAGGTCTCTTTAGCGACACCGTGGTGGGATGCCGAAGAGTACCATCAAAAGTACTACAATAAACCGCGCGTGTCGCGTTTCGGGTGG 
Protein Sequence
MRAAVATARVAAPSRASANKRNVRALAAMPASKDARRTDRGDGFVVPENCQLAVFASGUFWGPDASFSALKGVKNVRVGYTGGESDFPTYSAVCAGGTGHTEGYYVAYDAATTSFDKLLEQFWSEHQPTYESKAQYKSAIWAQTPEQYEKAVASKEAREKQVQRKFFTDIYPPEVSLATPWWDAEEYHQKYYNKPRVSRFGW 
SECIS Sequence
UUGUUUUCGCGCAGCGACGUCCGCGCGCGCGUGACGACGAAAUCGCAAAAGACGCCAUUGCGUCUGAGAUUUCGUCCGAUGAAAGCGCGCGACGAUCGCA 

Structure Picture