Mi.pu-MSRA-3-U

General Information

Protein ID
428 
External ID
 

Protein Information

Protein Name
Mi.pu-MSRA-3-U 
Family
MSRA 
Species
Micromonas pusilla CCMP1545 
Genome
GG663737 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
GCGAGAGCGTCCGGATCCGCGAAGACGACCGAGACCGCGGTGTTCGCGCTCGGGTGATTCTGGGGCCCGGAGGCTCGCTTCGGCAAGCTTCCCGGGGTGGTCTCCACGCGGGTGGGGTACACCGGCGGCGACGCGCCCGCGCCGACGTACGGCAGCGTGTGCGGCGGCGACGGACACACGGAGGCGATCTCGATCGAGTTCGACCCGAACGTCGTGACGTACGACGAGCTCCTGGACCGGTTCTGGGAGGAGCACAACCCGTCGGGGTACAAGCCGAAGGCGCAGTACAAGTCCGCGATATGGCCGACGACGGACGCGCAGTTGGAGATGGCGCGCGCGAGCGTGGAGAAGATCAGGTCCAAGTACGGAGACGTGCACACGGACGTCGAGCCCGCGAAAGAATGGCACGACGCCGAGGAGTACCACCAGAAGTACTTCGATAAGATGAAG 
Protein Sequence
ARASGSAKTTETAVFALGUFWGPEARFGKLPGVVSTRVGYTGGDAPAPTYGSVCGGDGHTEAISIEFDPNVVTYDELLDRFWEEHNPSGYKPKAQYKSAIWPTTDAQLEMARASVEKIRSKYGDVHTDVEPAKEWHDAEEYHQKYFDKMK 
SECIS Sequence
UCGCGUUCGUCCCUCGGACGCCGUCUCUGAUGAGGGUCGACGGUCCACGCGCAGCGACGUCGGGGCGGAGUCGAAAGGCGUCAGUCGGGGAUUGAGU 

Structure Picture