Ch.re-SELENOT-1-U

General Information

Protein ID
424 
External ID
 

Protein Information

Protein Name
Ch.re-SELENOT-1-U 
Family
SELENOT 
Species
Chlamydomonas reinhardtii 
Genome
DS496108 
EST
gi|15371049|gb|BI530475.1|BI530475,gi|9028153|gb|BE238193.1|BE238193,gi|22068061|gb|BQ818029.1|BQ818029 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGCAAGGGCTCCACAAAGGAGCAATTCTATTAGGTATAGTTGCCCTCTTTATTGGGGCTGACTGCTTCGGCGTTATGGGAGGCAGTAAGGCGCCTTCGCAGGCGCGTGTCCAGAGCGCAATGGACCCTGACGGCGGCCTGAGCCTCGGCGGCAAGCTGCACGTCTCCTTCTGCAACAGCTGAGGCATGCGTGGCGCCTTCGTGCAAGTTATGGAGCTTGCCCGAAGGCGTTACCCTGGGCTGGAGGTGGTGGGCACGCCCTACCCGCTCCCGGCCTGGAAGGTGCCTGTTGTGAAGGCGCTGCAGGTGGTGCAGTTCGGGCTGCTGGGCATGTGTCTGGCGGGGGACAAGGTGTTTGCGGCGCTGGGCGTGCCCGTGCCGGCCTGGTACACGCAGAACGTGGCGAGCAACCGCTTCGGAGCGGCGATGGGCGTGTGGTTTGTTGGCAACATGGTGGTCACCAACATGCAGAACACCGGGGCGTTCGAGGTGTTCTTCAACGGTGACCTGATCTTCTCCAAGCTTGCGGAGGGCCGCATGCCCTCGGTGCCGGAGCTGATCAGCCCCATGCAGGCGTTCTTTGAGGGGCCGGCGGGGCTGCATGTTGGCGGCGCCGGTGCCTCGCGCCCGGGCCTGACCGGCGCCGGCATGGGCCACGGACCGGAGCTG 
Protein Sequence
MQGLHKGAILLGIVALFIGADCFGVMGGSKAPSQARVQSAMDPDGGLSLGGKLHVSFCNSUGMRGAFVQVMELARRRYPGLEVVGTPYPLPAWKVPVVKALQVVQFGLLGMCLAGDKVFAALGVPVPAWYTQNVASNRFGAAMGVWFVGNMVVTNMQNTGAFEVFFNGDLIFSKLAEGRMPSVPELISPMQAFFEGPAGLHVGGAGASRPGLTGAGMGHGPEL 
SECIS Sequence
MQGLHKGAILLGIVALFIGADCFGVMGGSKAPSQARVQSAMDPDGGLSLGGKLHVSFCNSUGMRGAFVQVMELARRRYPGLEVVGTPYPLPAWKVPVVKALQVVQFGLLGMCLAGDKVFAALGVPVPAWYTQNVASNRFGAAMGVWFVGNMVVTNMQNTGAFEVRAGCRIFSKLAEGRMPSVPELISPMQAFFEGPAGLHVGGAGASRPGLTGAGMGHGPEL 

Structure Picture