Em.hu-SELENOM-7-U

General Information

Protein ID
423 
External ID
 

Protein Information

Protein Name
Em.hu-SELENOM-7-U 
Family
SELENOM 
Species
Emiliania huxleyi 
Genome
KB867194 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
CTGGGCCTCTTGTCGCTGATGTGCGCCGCGCACGCTCAGCTGACCGGCGTGATCGAGACGTGTTCCGGATGAAAGTTAAACAAGCACAAGGGCATCAAGCGCTTCGTGAAGGGCGACGCCGGTGCTCAAGAGGGATACGCCGCCAACTGGATTGGCCTGTCTGTCAAATACATTCCGGGCCACAATCCGGACCTGGTCATTTACGAGGGGGGCGTGGAACAGGAGAGAATCAATCTGCTCACGATTCCGATGGGCGCGAAAAGGTCACCCGACGTGGACGACATCTACAACCTTCTCATGAGCAAGGGCTTTCAGATGTCGCTCGAGGAGGCGCAATCATCGCCCGGGCCTGCAATCAGTGGGTCGCGTAGGGGGAGAGTCCAGCCTTGCCCTCCAACCGCGCGCGAGGAGACA 
Protein Sequence
LGLLSLMCAAHAQLTGVIETCSGUKLNKHKGIKRFVKGDAGAQEGYAANWIGLSVKYIPGHNPDLVIYEGGVEQERINLLTIPMGAKRSPDVDDIYNLLMSKGFQMSLEEAQSSPGPAISGSRRGRVQPCPPTAREET 
SECIS Sequence
AUGUGCGCCCUGCUAUGCACGCGGGGUUUGAUGAUGCCGGCUUGAGAAAACUCGCAAGCCGCGAGUCUCAGCGCGGCGGAUGGCUUCUCCCCGGCAUUCAGGUGAC 

Structure Picture