Te.ob-SELENOM-1-U

General Information

Protein ID
418 
External ID
 

Protein Information

Protein Name
Te.ob-SELENOM-1-U 
Family
SELENOM 
Species
Tetradesmus obliquus 
Genome
 
EST
gi|106868722|gb|EC187099.1|EC187099 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGAAGACGATAGTGGTCTTCTTGGTCGCATGTTTGGGCTTTGTGGCTGCCCAAGATGCCGTGAAGACGGTGACCACCGGAGTCTTTGAAAGCTGCTCTGGCTGACGCTTGAACTCGTTGCCTGAGGTGAAGCACTTCATCTACGAATCTGTGCTCAAGGAAGAGTACAAGGGTTTGTCAGTGCAGTTCATCCCAGGTGCGATGCCAGAGCTGGTCATGTACAAGAGGCAGGCTGGTGGGGAGGCTGAGGAGGTGTCCAGGGAGTCCCTGCAGGACCTCAATGAGGAGCAGCTGCATGAGCTGATGCAGCAGCGCGGCTTCACCCGCGTGCCAGTGGAGCCAGAGCAGCAGGAGCAGCCCCCAGGCCCAGACGACGATGGTGCTGAGGTTGAGGGCGTTACATTCTATGATCGCCCGTATGACGAGGAGGCAGGGGGGCATGGGGAGCTGTAG 
Protein Sequence
MKTIVVFLVACLGFVAAQDAVKTVTTGVFESCSGURLNSLPEVKHFIYESVLKEEYKGLSVQFIPGAMPELVMYKRQAGGEAEEVSRESLQDLNEEQLHELMQQRGFTRVPVEPEQQEQPPGPDDDGAEVEGVTFYDRPYDEEAGGHGEL* 
SECIS Sequence
 

Structure Picture