2_Th.ps_SELENOT_E

General Information

Protein ID
417 
External ID
 

Protein Information

Protein Name
2_Th.ps_SELENOT_E 
Family
SELENOT 
Species
Thalassiosira pseudonana 
Genome
 
EST
gi|162389341|gb|FC531053.1|FC531053,gi|162367114|gb|FC509304.1|FC509304,gi|162386195|gb|FC527803.1|FC527803,gi|162367542|gb|FC508955.1|FC508955 
Functional Domain
 
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
CGCACCTACACCTACCAAGGAACCCAACACGCAAAACCTACACAAAGCCTTTGTCCAGTTTTGCACTCAATGAGGTATGAAGGCCAACTTTCTCCGCGTACGCGAGATTCTCATCAATGAATTTCCTGGACAATGGAGCAGTATTGAAGGAGAAAACTACCCGGCTCCTGAATGGACTAAGTTGGCTGGAAGTGTGGTATCAGCGTTGCAGATATTTGTTATGGTGTTGGTGATGGTTGGAGATTCTATTTGGAGTTATATCCCTGGTTTTAGACGGGGTCCTCCCGAGGTGTACTACAAGTTGAAGGATAATCCGGCGTTGGCTTTGATTGGAGTCTTTTTGATCATTCCCTCGTACATTCAATCATTTGCAAATACTGGAGCTTTTGAAATCATGTTGGATGGGAAAGTGATATTCTCAAAGTTGGAGTTGGGGAGAATGCCAAACGTTGCCGAGATCATTAAAGCAGTAGAAAGTGCTGGATTGCATCGAGGTAGATAG 
Protein Sequence
RTYTYQGTQHAKPTQSLCPXCTQUGMKANFLRVREILINEFPGQWSSIEGENYPAPEWTKLAGSVVSALQIFVMVLVMVGDSIWSYIPGFRRGPPEVYYKLKDNPALALIGVFLIIPSYIQSFANTGAFEIMLDGKVIFSKLELGRMPNVAEIIKAVESAGLHRGR* 
SECIS Sequence
 

Structure Picture