Sa.ja-SELENOM-1-U

General Information

Protein ID
411 
External ID
 

Protein Information

Protein Name
Sa.ja-SELENOM-1-U 
Family
SELENOM 
Species
Saccharina japonica 
Genome
JXRI01000607 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
TTATTGGTCGGGGCCCTTCTCTCGGCCCAGGCATGCGCGCAGGCGGCCGTGAGGGGCCGCATCGAGTCCTGCAGCGGATGAAAGCTAAACAAGCTCCCCGAGGTCAGGAAGTTTATCAAGGACCCCGAGCACGCTACCAGCTACGAGGATGTCGAGGTGGAGTTCGTGAGAGGCAGGCCGCCGGTGCTGACCATCTACGACAAGGCCTCCGGGGAGACCGCGGAGACCATCAACCTTGAGAAGCTCAACCTTGAGGAGATGCACGAGCTACTCGTTTCCCGAGGCTTCGTTCGCCGT 
Protein Sequence
LLVGALLSAQACAQAAVRGRIESCSGUKLNKLPEVRKFIKDPEHATSYEDVEVEFVRGRPPVLTIYDKASGETAETINLEKLNLEEMHELLVSRGFVRR 
SECIS Sequence
CUAAGCCGUGGACUGUUUUCCGUGGGCGUAAUGACGGAUGCACCUGCCAAAACCCUUACAGGGGGAAUGGGUCAUCUUGAAACGCCUCGAUAAUUUUUCCGGCGG 

Structure Picture