2_Th.ps_SELENOH_Mg

General Information

Protein ID
41 
External ID
 

Protein Information

Protein Name
2_Th.ps_SELENOH_Mg 
Family
SELENOH 
Species
Thalassiosira pseudonana 
Genome
CM000641 
EST
gi|162395145|gb|FC536615.1|FC536615 
Functional Domain
 
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGAGTGATATTAGCTTCACTGTTACCTATTGTCGCAACTGAGACGGGGGAGGCCAAGAGCGAGACACTGCCATAGCCTGCGTACGAGAAGTCTTTCCGTCTGCAAAGATCACCCCCAACTGTGTCAATTCCTATCCTATCCGTGTGAAAATCGAATCTCACGAAGGTGGAAAGAGTCACGTCGTGTGGGAAGGAGATCAAAAGAGTTTGTTTAGAAAGTACGCCAGTAGGAGAAAGCAAGCACAGGAGGAGATGATACGTCGATTGAACGCGTTGAAGGCTTCCAAGCTATAG 
Protein Sequence
MSDISFTVTYCRNUDGGGQERDTAIACVREVFPSAKITPNCVNSYPIRVKIESHEGGKSHVVWEGDQKSLFRKYASRRKQAQEEMIRRLNALKASKL* 
SECIS Sequence
CRNUDGGGQERDTAIACVREVFPSAKITPNCVNSYPIRVKIESHEGGKSHVVWEGDQKSLFRKYASRRKQAQEEMIRRL 

Structure Picture