Fr.cy-SELENOH-2-U

General Information

Protein ID
406 
External ID
 

Protein Information

Protein Name
Fr.cy-SELENOH-2-U 
Family
SELENOH 
Species
Fragilariopsis cylindrus 
Genome
scaffold_9 
EST
gi|282254761|gb|GW067537.1|GW067537 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
AAGAAGGAAACGACGACGACGAAGAAGACGAAAAAGGAATCAGTTACCAAGGCGGCTAGTACCGCTACGAAATCCAAAAAGAAAAAGGAAACAGTTGCCGTTATTGCAAAGGCTAAGAAAGCTGTCGCCAAGAAGGTTGTTGCGCCCACTGCTGTCAAAAAAGCTGCTGCTGCTGCTGCTGCTGCAGTAGTTGGTAGCGAGGGAAAGAAAATTGTAATCATTGAAGCATGTAAACAATGAGGTGCATTCAAATCTCGTGCTAATAAGATTCTGAAGGCGGTTGGTGATAAAGCTACCGTACAGATTAACTTAGAAAAGCCGGGAAAAGGGAACTTTGTAGTTTCTGTTGAAGGGATCGACGAACCAATCGTTTCATTACTTGCCATGAAACGTCCCTTTCCGACCCTCAAGGCACTTGACATGGATGAAATCAATGAAAAAGTTATTTCAGCTTTGTCATAA 
Protein Sequence
KKETTTTKKTKKESVTKAASTATKSKKKKETVAVIAKAKKAVAKKVVAPTAVKKAAAAAAAAVVGSEGKKIVIIEACKQUGAFKSRANKILKAVGDKATVQINLEKPGKGNFVVSVEGIDEPIVSLLAMKRPFPTLKALDMDEINEKVISALS* 
SECIS Sequence
KAAAAAAAAVVGSEGKKIVIIEACKQUGAFKSRANKILKAVGDKATVQINLEKPGKGNFVVSVEGIDEPIVSLLAMKRPFPTLKALDMDEINEKVISALS 

Structure Picture