Ch.re-MSRA-1-U

General Information

Protein ID
403 
External ID
 

Protein Information

Protein Name
Ch.re-MSRA-1-U 
Family
MSRA 
Species
Chlamydomonas reinhardtii 
Genome
DS496109 
EST
gi|22068720|gb|BQ818534.1|BQ818534,gi|14236054|gb|BG854870.1|BG854870,gi|10128274|gb|BE726978.1|BE726978,gi|15369747|gb|BI529157.1|BI529157,gi|22054005|gb|BQ811090.1|BQ811090 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGGCGACTAACGGGAACGGAGCTTCTGGCGCGGAGCTCGCCACTTTCGCGCTTGGCTGATTCTGGCACCCGGAGGCTTCGTTCGCGAAGCTTCCCGGTGTGGTGAAGACTCGCGTGGGCTACACGGGCGGCAGCCGCCCCAACCCCACCTACGAGTCTGTGTGCGCTGGCGACGGCCACACAGAGGCGATGCGGGTCTGGTTTGACCCTGCCATCATCTCGTACGAGGACCTGCTCAAGCAATTCTTCCGGGAGCACGACCCCACCCAGAAGTCCAAATGCCAGTACAAGTCGGCTGTGTGGTACCATAGCGAGGCGCAGCGCACCGCCCTGGCCGCCGTGATGAAGGAGCTGGAGGGCAAGTACCGCGTGCGGCTGGCCACCACTGTGGACCCCGCCGGGGACTGGTGGGACGCGGAGGAGTACCACCAGAAATACATTGAGAAGTCCATGATGCGCCGTGGCTCTGCGGGCTGGTGG 
Protein Sequence
MATNGNGASGAELATFALGUFWHPEASFAKLPGVVKTRVGYTGGSRPNPTYESVCAGDGHTEAMRVWFDPAIISYEDLLKQFFREHDPTQKSKCQYKSAVWYHSEAQRTALAAVMKELEGKYRVRLATTVDPAGDWWDAEEYHQKYIEKSMMRRGSAGWW 
SECIS Sequence
MATNGNGASGAELATFALGUFWHPEASFAKLPGVVKTRVGYTGGSRPNPTYESVCAGDGHTEAMRVWFDPAIISYEDLLKQFFREHDPTQKSKCQYKSAVWYHSEAQRTALAAVMKELEGKYRVRLATTVDPAGDWWDAEEYHQKYIEKSMMRRGSAGWW 

Structure Picture