Fr.cy-SELENOT-1-U

General Information

Protein ID
External ID
 

Protein Information

Protein Name
Fr.cy-SELENOT-1-U 
Family
SELENOT 
Species
Fragilariopsis cylindrus 
Genome
scaffold_11 
EST
gi|282252484|gb|GW067017.1|GW067017,gi|66748813|gb|DR026450.1|DR026450 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGACGGGTGGTGGCGCTGGTGGCGACCATTCCGTCCATATCCAATTTTGTGTGAGCTGAGGGTCAAAACGTAACTTTCTTCAGGTAAGGGATTGGTTAGAACAAACCTTTCCGGAATTACGTGGGAAAGTTACGGGTGATAATTATCCACCACCACCAATAGCAGAATTATTAATGAAATTCTTATCTGTAATCCAATTAGCTGGTATGGCTGTCGCATTAATTGGTGAGAATGTATTTAGATTTATTGGTATGTCACGACCACCATCATGGTACGGTGATATTGTTGTAAAAAATGCTGTACCACTTGGTATTGGTCTATATTTGATTGTACCACAAATTTTGAATGGTTATATCGTATCGAATGCATTTGAGGTTGTATTAGATGGAACAGAAACCATCTTTAGTAAAATAGCAACAGGTCGGATGCCTGCAGCAGAAGATTTAATTGATCCATTAACTAGATTTGGTCTATTGTCAGTTGGAGTAGCACCAAAATAA 
Protein Sequence
MTGGGAGGDHSVHIQFCVSUGSKRNFLQVRDWLEQTFPELRGKVTGDNYPPPPIAELLMKFLSVIQLAGMAVALIGENVFRFIGMSRPPSWYGDIVVKNAVPLGIGLYLIVPQILNGYIVSNAFEVVLDGTETIFSKIATGRMPAAEDLIDPLTRFGLLSVGVAPK* 
SECIS Sequence
GGGAGGDHSVHIQFCVSUGSKRNFLQVRDWLEQTFPELRGKVTGDNYPPPPIAELLMKFLSVIQLAGMAVALIGENVFRFIGMSRPPSWYGDIVVKNAVPLGIGLYLIVPQILNGYIVSNAFEVVLDGTETIFSKIATGRMPAAEDLIDPLTRFGL 

Structure Picture