Ba.pr-SELENOH-1-U

General Information

Protein ID
395 
External ID
 

Protein Information

Protein Name
Ba.pr-SELENOH-1-U 
Family
SELENOH 
Species
Bathycoccus prasinos 
Genome
NC_024001 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
AAAATGTGACAAGCGTTCGTCCGCGTCGCGAATCAGTTGAAAGCGGAGCTCAACGGCGAGTTAGAGATCACGCGAGATGCCTCCGCGGGGACGTTTGAGGTCCTCGTGAACGAGAAAATCGTGTGGACAATCACGGAGAAACGACCGTTCCCGAAACTGAAAGCGAAAAATATGAGCGACGTCGCCGCTTTGGTGAGGAAAGCTTTG 
Protein Sequence
KMUQAFVRVANQLKAELNGELEITRDASAGTFEVLVNEKIVWTITEKRPFPKLKAKNMSDVAALVRKAL 
SECIS Sequence
AGGAGAGGGAUGAUACUAAGCGGACGAAACGUGAACGCGUCGACGAGAAAUACAUGUGAAAACAAACACUCGCGAUUGCGGGAUACUUCGUGCGUUGUUAUUAU 

Structure Picture