Em.hu-SELENOM-1-U

General Information

Protein ID
385 
External ID
 

Protein Information

Protein Name
Em.hu-SELENOM-1-U 
Family
SELENOM 
Species
Emiliania huxleyi 
Genome
KB863011 
EST
gi|261455358|gb|FP213161.1|FP213161,gi|261430402|gb|FP218456.1|FP218456,gi|261427623|gb|FP185305.1|FP185305,gi|261424357|gb|FP184229.1|FP184229,gi|261455887|gb|FP233684.1|FP233684,gi|261443936|gb|FP210007.1|FP210007,gi|261427350|gb|FP194976.1|FP194976 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGGTACGACCCCGAGGTTGCATCGGTTCAGCTGTCGCGCTAACTCTCGCCGCGCTCTCGTCGACCAATGCGGCCGTCGGCGTCGTAAAGTCTTGCCCTGCTTGAGGGCTCGACGCGCTGCCGATGGTGAAAAAATTCCTCAAGTCGCCGGGCGGCGTGGAGCTCTATCCATCCGTGAACATCGAGTGGATCAAGGGCCATGACCCGACTCTCTACGTGACAGGTGACGGCCCAGCGGAAGAGATCGGACTCGGCAAGTTCAACTACACACAGCTACACGAACTCTTCGCCCGCAAGTTTGGGCGCGTGGCCTTGCGAGATGAAGCGGCCGGCTCAACCTGGAAAAGGCCGGCTGCGGACGATGCAGGGTCGCCTGCCGGAGCAGGCAGCAGGAGACTCCTCTTCATGCTGACGGGCGGAGCGATCGTCACAGCGCTCTACGCTGCAGCCGCGCGGCGCTCTCGCGCCCGCGGCGGCTGGGACGCAGCGAACGACGAAGACGAGCTGAAGCAACGGCTCACGGCATGA 
Protein Sequence
MVRPRGCIGSAVALTLAALSSTNAAVGVVKSCPAUGLDALPMVKKFLKSPGGVELYPSVNIEWIKGHDPTLYVTGDGPAEEIGLGKFNYTQLHELFARKFGRVALRDEAAGSTWKRPAADDAGSPAGAGSRRLLFMLTGGAIVTALYAAAARRSRARGGWDAANDEDELKQRLTA* 
SECIS Sequence
GSAVALTLAALSSTNAAVGVVKSCPAUGLDALPMVKKFLKSPGGVELYPSVNIEWIKGHDPTLYVTGDGPAEEIGLGKFNYTQLHELFARK 

Structure Picture