Vo.ca-SELENOM-1-U

General Information

Protein ID
377 
External ID
 

Protein Information

Protein Name
Vo.ca-SELENOM-1-U 
Family
SELENOM 
Species
Volvox carteri 
Genome
GL378431 
EST
gi|167097423|gb|FD818474.1|FD818474,gi|167192862|gb|FD917889.1|FD917889,gi|167186946|gb|FD908911.1|FD908911,gi|167203865|gb|FD924416.1|FD924416,gi|167182700|gb|FD905597.1|FD905597,gi|167195628|gb|FD915716.1|FD915716,gi|167128611|gb|FD852978.1|FD852978 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGTTGCTTGCGCTGTTGTGCAGTAAGCTCACACCTTTAGCGCAAGGACAGGCAGGCAGGGTTGCAAAAGCAGAGTTTATCAGTTGCCCTGGCTGACGATTGAACCACCTGCCCGAGGTTAAGAGGTTTCTGAAAGGCGATATCGAGCAAGGTGCCTACGAAAACGTCGCCGTAAACTTCATTCCGGGCAGGATTCCAGAGCTGGTACTCTACGATTCAAATAATGTTGAGGTTGAGCGGATGTTCGTCGACAAGCTCAAGTATGATGAGCTCCACACACTTATCCAAACCAAAGGCTTTCATCGGAAAGTTCTCGGTGCCACAGCTGTCCGCTTGCGTACCTTCCGGAGGGTATTGTGGTGGCTGGTTTGA 
Protein Sequence
MLLALLCSKLTPLAQGQAGRVAKAEFISCPGURLNHLPEVKRFLKGDIEQGAYENVAVNFIPGRIPELVLYDSNNVEVERMFVDKLKYDELHTLIQTKGFHRKVLGATAVRLRTFRRVLWWLV* 
SECIS Sequence
LALLCSKLTPLAQGQAGRVAKAEFISCPGURLNHLPEVKRFLKGDIEQGAYENVAVNFIPGRIPELVLYDSNNVEVERMFVDKLKYDELHTLIQTKGFHRK 

Structure Picture