1_Em.hu_SELENOT_E

General Information

Protein ID
376 
External ID
 

Protein Information

Protein Name
1_Em.hu_SELENOT_E 
Family
SELENOT 
Species
Emiliania huxleyi 
Genome
 
EST
gi|115599200|gb|EG031565.1|EG031565,gi|58188071|gb|CX777718.1|CX777718,gi|208410077|gb|GE149979.1|GE149979,gi|208637507|gb|GE191377.1|GE191377 
Functional Domain
 
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
GTCGCGCGGCCGGCAATCGAGCGGCACGACTCGACGGTTCGGATCGAGTTCTGCCGCTCCTGACAGACGGCGGGCGCCTTCCGGCAGTGCGCTCTCGCGCTCCAGTCGGCGTTCCCCGGCGTGCCCATTGAGGGCGGCGATTACACACCTCCTGTGGGCGTGCAGTACGCCATCCGTACCGTGCGGGCGGCGCAGGCGCTGGTGGCTCTCAGCTACTTCTTCGGAGAGCAGGCGGCGGTTGCGGTTCGGCGGCCGACGCCGCGCGCGGTCCTTCAGATGCACGATAATCCGATGCTCGCGATCGGCGGCGCGTTCGCTCTGGACGTGGTCGCGCAGACGCTGCAGTCGATCAATGCGTTTGAGGTAACCTACAACGGCCAGAAGCTGCACTCCAAGCTTGCCACCGGTCGGATGCCCCAGCCGGTGGAGCTGGTTCGGCAGCTCGAGACGATGCGCGCAAAGGAGAAGACGCGCACGCAGGGAGCGGCGGAGGCGTCGGCGCCCAAAGTGCGCATCGAGTAG 
Protein Sequence
VARPAIERHDSTVRIEFCRSUQTAGAFRQCALALQSAFPGVPIEGGDYTPPVGVQYAIRTVRAAQALVALSYFFGEQAAVAVRRPTPRAVLQMHDNPMLAIGGAFALDVVAQTLQSINAFEVTYNGQKLHSKLATGRMPQPVELVRQLETMRAKEKTRTQGAAEASAPKVRIE* 
SECIS Sequence
 

Structure Picture