Mi.pu-SELENOM-2-U

General Information

Protein ID
375 
External ID
 

Protein Information

Protein Name
Mi.pu-SELENOM-2-U 
Family
SELENOM 
Species
Micromonas pusilla CCMP1545 
Genome
GG663744 
EST
gi|303284830|ref|XM_003061660.1| 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGGCGTCGTCCTCCGCGCGCGTCCTCGCGACGCTCCTCGGGTTCCTCCTGGTCGCGGTCGCGACCGCGCCCGCCGCCGCGGACGCCGCGCGATCCCTCCGCGCCGCGGACGTCCCCGCCGCCGCCGGCGCGCGCGCGGTCTTCGTCAGCTGTCCGAGCTGACGACTGAAGCGCTTCCCCGAGCTCAAGCGGCTCATGAAGGACGAGGTCGAGGCGGGCGCGTGGGGCGACGACGTGACGGTGAAGTGGGAGCACGGGCACCCGGTGACGCTCGTGGTGTACGGCGACGACGGGAAGACGGAGGTGATGCGCGAGAACGTGGAGGACTGGGGGATACGGAAGGTGCGGGAGACGCTCAGCGAGCGCGGGTTTCGAAAGACCGACGACGACGGCGGTTTTGGAGGAGGAGGCGGCGTGCGGCGGGCGAACGACGTGAACGCGTTCGCCGCGTTCTCGAAGTCCGGCGAGGCGGACCGGACGACGGTCAGGACGCAGCCGATCAACGCTGGATAG 
Protein Sequence
MASSSARVLATLLGFLLVAVATAPAAADAARSLRAADVPAAAGARAVFVSCPSURLKRFPELKRLMKDEVEAGAWGDDVTVKWEHGHPVTLVVYGDDGKTEVMRENVEDWGIRKVRETLSERGFRKTDDDGGFGGGGGVRRANDVNAFAAFSKSGEADRTTVRTQPINAG* 
SECIS Sequence
MASSSARVLATLLGFLLVAVATAPAAADAARSLRAADVPAAAGARAVFVSCPSURLKRFPELKRLMKDEVEAGAWGDDVTVKWEHGHPVTLVVYGDDGKTEVMRENVEDWGIRKVRETLSERGFRKTDDDGGFGGGGGVRRANDVNAFAAFSKSGEADRTTVRTQPINAG 

Structure Picture