Cy.pa-SELENOM-1-U

General Information

Protein ID
370 
External ID
 

Protein Information

Protein Name
Cy.pa-SELENOM-1-U 
Family
SELENOM 
Species
Cyanophora paradoxa 
Genome
Contig9722 
EST
gi|138234431|gb|ES235747.1|ES235747,gi|138230650|gb|ES231966.1|ES231966,gi|117873844|gb|EG946540.1|EG946540 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
CGCTAAGCCGAAGGCCGTGCGCGCCGTCTTGGAGACCTGCAGCGGATGAAGACTGAACCGGCTCCCGATCGTTAAGAGCTTCATTAACGACGAGAGCCGGCAGTACGCGGCCTTGGAGGTGAAATACATCCCCGGGCTCACTCCGCGTTTCGTCTTCTACGATGCTGCGGATCAGGAGTTGCATCGCGTCGACATCGACGAGTTCAACAATGACCGCATCCACTCCGAGCTTCAGAACTGGGGCCTCAAGCGCCAGATCTGA 
Protein Sequence
AKPKAVRAVLETCSGURLNRLPIVKSFINDESRQYAALEVKYIPGLTPRFVFYDAADQELHRVDIDEFNNDRIHSELQNWGLKRQI* 
SECIS Sequence
RAVLETCSGURLNRLPIVKSFINDESRQYAALEVKYIPGLTPRFVFYDAADQELHRVDIDEFNNDRIHSELQNWGLKRQ 

Structure Picture