Mi.co-SELENOT-1-U

General Information

Protein ID
363 
External ID
 

Protein Information

Protein Name
Mi.co-SELENOT-1-U 
Family
SELENOT 
Species
Micromonas commoda 
Genome
CP001331 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
GTGCACATCTCCTTCTGCCAATCCTGACAGTACAGGGGCGGCTTTGCGCACGTCCGGAACGCCATCTCGCAACGCTTCCCGGAGTGCCAAGTCGTCGGATCCAACTACCCGCCGTCCCCCGTCGCGGTCGTGGGCGCCAAGCTCGTCAACGTCGCCACGTGGACCACCCTCGCGTTGACGCACGCGGGCGACTCCATGGTTCGAGCGTTCGGGCTGGCGCAAGCGCCCGACTTTGTGACCAACCTGCAGGCGAACAAGATGGGGAGCACGATGGGCGCGTGGTTCCTGGGTAACACCCTGTCGCAGAACATGCTCAACACCGGCGCGTTCGAGGTGTACTACGACGGCGAGACGATCTTCTCCAAGATTCGCTCGGGCCGCCTGCCGTCGATGCCGGAGATCATGACCGGGCTGGAGGAAGCCATCGACCGGCGAAGGGAACTGGAGTCCGCACCCGCCGCCGCCGAGCTGCCCGTCCCC 
Protein Sequence
VHISFCQSUQYRGGFAHVRNAISQRFPECQVVGSNYPPSPVAVVGAKLVNVATWTTLALTHAGDSMVRAFGLAQAPDFVTNLQANKMGSTMGAWFLGNTLSQNMLNTGAFEVYYDGETIFSKIRSGRLPSMPEIMTGLEEAIDRRRELESAPAAAELPVP 
SECIS Sequence
GUCGAGCCGCGCGUCCCGCCCCCCCCACCCGUGACGGCUGCGCUCCAAAGCUUUGAGGAGCGCGGGCCCGAUUUUUUGUGCGGGGGCGAUGCACCGC 

Structure Picture