1_Gu.th_SELENOH_E

General Information

Protein ID
359 
External ID
 

Protein Information

Protein Name
1_Gu.th_SELENOH_E 
Family
SELENOH 
Species
Guillardia theta 
Genome
 
EST
gi|117393402|gb|EG727857.1|EG727857,gi|557430858|gb|HE987005.1|HE987005,gi|557430857|gb|HE987004.1|HE987004,gi|117385641|gb|EG720096.1|EG720096 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGGCAGAGTTCGTTGTGGAATATTGCTCCAACTGAGATGGTGGGAGGCAGGAGATGAGGTCGGCAAGCGAAGCAGTCGCTGCCGGTGCTCCTTCTGCCAAGATCTCGACGTCTTGCATCGACAGGATGGGTGCGATTTTCGTCGTCATCTACAAGTGCGAGAACGGCGCAAAGCGGAAGATCTACACCACTGATCAGAGGAATCTGTTCCGCAAGTACCCAGATCGACGATCGAAGGCGATGGCGGAGATCACTGCTATCGTACGGCAGGAGATGGGGAAGTAG 
Protein Sequence
MAEFVVEYCSNUDGGRQEMRSASEAVAAGAPSAKISTSCIDRMGAIFVVIYKCENGAKRKIYTTDQRNLFRKYPDRRSKAMAEITAIVRQEMGK* 
SECIS Sequence
 

Structure Picture