Ka.ve-SELENOM-1-U

General Information

Protein ID
349 
External ID
 

Protein Information

Protein Name
Ka.ve-SELENOM-1-U 
Family
SELENOM 
Species
Karlodinium veneficum 
Genome
 
EST
gi|106835061|gb|EC153438.1|EC153438,gi|106836578|gb|EC154955.1|EC154955 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGGCTACTTTCCGATTAGTAGCTTTCGGGCTGGCTCTGGGGGCAGTGAGAGCAGCTGCCAAGACCACAGGAAAAAGTTGTAATGCAAAGTCCTGCGACGCAGATGGCAATTGCGAGGACCGTCGGTGCACCTTGATCGATGGTGATGCACAGCTGAAGCCAGCACAGAAAGGCAAAATCATGTCATGCCAGGGATGAAAACTAAATCACTTTGATGATGTCCGCCGATGGCTGAGGGACGAGCAACGCTGGAAGGAGTGGCAGAACCTAGAAGTGCAGTGGGTGCAGGGTCACAATCCTGACTTGATTGTTCTCAGCGAGAGTGGGCAAGAGACGGAACGCGTTGATCTCACCCAATTTTCCTACACTCAGTTCCCCGAGATGTTGCGTAAGAGAGGATTCCGTATGCAAGGAGAGTATTAA 
Protein Sequence
MATFRLVAFGLALGAVRAAAKTTGKSCNAKSCDADGNCEDRRCTLIDGDAQLKPAQKGKIMSCQGUKLNHFDDVRRWLRDEQRWKEWQNLEVQWVQGHNPDLIVLSESGQETERVDLTQFSYTQFPEMLRKRGFRMQGEY* 
SECIS Sequence
 

Structure Picture