7_Em.hu_SELENOM_E

General Information

Protein ID
346 
External ID
 

Protein Information

Protein Name
7_Em.hu_SELENOM_E 
Family
SELENOM 
Species
Emiliania huxleyi 
Genome
 
EST
gi|58184326|gb|CX773973.1|CX773973,gi|116109394|gb|EG358053.1|EG358053 
Functional Domain
 
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGCTCTCCGGCGCTGTGCTCACCTTGCTGGCCGCGTCGGCCGCGAAGAAGGCCGCGGGCGGTGGCGGGTGCGAGGTCACCTCGACGTGGCCGGATGGGCGCGTGGAGCAGCGTCAGTGCGTGGTGCAGGCCGTCTCGGACAGGCCCGGTGCACGCGGCCGCTTTGAGAGCTGCACGGCCTGAAAGCTGGACGAGGAGCACAACGCGAGGCTCCGGCGATACCTGAAGCAGGACGAGGGGTGGAAGGAGTGGGAGGGCCTGGAGATGCAGTGGATCAGGCACCACAACCCCGACCTGGTCGTCCTCGACGACAACGGGCGCGAAAAGGCGAGGGTCGACCTGAACGGCTACGATGGGCCGCGGGTGGAGGCGCTGCTCGAGAAGCACGGCTTCAAGCGCAAGTAA 
Protein Sequence
MLSGAVLTLLAASAAKKAAGGGGCEVTSTWPDGRVEQRQCVVQAVSDRPGARGRFESCTAUKLDEEHNARLRRYLKQDEGWKEWEGLEMQWIRHHNPDLVVLDDNGREKARVDLNGYDGPRVEALLEKHGFKRK* 
SECIS Sequence
 

Structure Picture