Mi.co-MSRA-3-U

General Information

Protein ID
344 
External ID
 

Protein Information

Protein Name
Mi.co-MSRA-3-U 
Family
MSRA 
Species
Micromonas commoda 
Genome
CP001332 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
TCGGGGGCCAAGGACACCGAGACGGCCGTGTTCGCCCTCGGCTGATTCTGGGGCCCGGAGGCTCGCTTCGGCAAGCTTCCAGGCGTCGTGTCCACTCGCGTGGGTTACACCGGAGGGAAGACCGAGAACCCGACCTACGGAACCGTGTGCGGCGGCGACGGGCACACCGAGGCTCTCAAGGTTGAGTTCGACCCCAGGGTGATCTCCTACGACGATCTCTTGAACGCGTTCTGGGAAGAACACAACCCCAGCGGGTACAAGCCCAAGGCGCAGTACAAGTCCGCAATCTGGCCCACGAGCGAGTCCCAGAAGGAGAAAGCTTTGGCATCGAGGGCGGCGATCGAGGCCAAGTACGGCAGCGTGCACACGGACATCGAGGACGAGCAGCCTTGGTGGGACGCCGAGGAATATCACCAAAAATATTTCGATAAGATGTCGGGCCGCCAG 
Protein Sequence
SGAKDTETAVFALGUFWGPEARFGKLPGVVSTRVGYTGGKTENPTYGTVCGGDGHTEALKVEFDPRVISYDDLLNAFWEEHNPSGYKPKAQYKSAIWPTSESQKEKALASRAAIEAKYGSVHTDIEDEQPWWDAEEYHQKYFDKMSGRQ 
SECIS Sequence
CCGAGCUGCUCGAGCCCCUCAGCCUUGGGCUUGAACUCAUCCUUGGCGAAGUCGAACGCGCACUGGUGAUCGAUGAUGUCCCCGUUGUGCAGCACGAAG 

Structure Picture