1_Du.sa_SELENOH_E

General Information

Protein ID
340 
External ID
 

Protein Information

Protein Name
1_Du.sa_SELENOH_E 
Family
SELENOH 
Species
Dunaliella salina 
Genome
 
EST
gi|354981416|gb|HO848699.1|HO848699 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGTCAAGCAAGCAAGCTGAGCCCGAAGTGCAAGGTGGAAACGGAGAGGCCTTCGAGGTGCTCTACTGCCAAAACTGAGATGGCGGGATGCAGGAGTTCCAGACGGNCAAGCAAGCAATTTTGGCGGCGATCCCCAACGCCAATGTGCAAGGCAAGTACTGGGATGCCTACCCCATCACTGTTGCAGTAAAGCACAAAGCCTCTGGGCAAACTGTATGGTCAGGGGACCAGAGGTCCCTGTTCCGTAAGAACGCTGCGCGTCGTGCTGCAAGTCAGCAGGCCATCACCCAGGCGTGCGCAGCGCTCAAGGCTGCTTAA 
Protein Sequence
MSSKQAEPEVQGGNGEAFEVLYCQNUDGGMQEFQTXKQAILAAIPNANVQGKYWDAYPITVAVKHKASGQTVWSGDQRSLFRKNAARRAASQQAITQACAALKAA* 
SECIS Sequence
 

Structure Picture