At.sp-SELENOT-1-U

General Information

Protein ID
338 
External ID
 

Protein Information

Protein Name
At.sp-SELENOT-1-U 
Family
SELENOT 
Species
Attheya sp. CCMP212 
Genome
 
EST
gi|371498736|gb|JK727230.1|JK727230,gi|371498648|gb|JK727142.1|JK727142 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ACGCTGCAGGTGCTCTTTTGCACCTCGTGAGGCATGTCGAGGAACTTCCACCAACTCAAGGAGTTCCTCGAACAACACTTCCCCGAACTGGCCAACGGGGCGATTAAAGGGGCCAATTATCCCGCTCCTGCATGGGCGACAATAGCGTCACAAGCTATTATGTTTATGCAGGTCTTTACGATGATGGCGGTGTTTACTGGGGATGCATTTTGGAATTATATTCCGTTTGTGCAGGGCGCGCCCAGTTGGTACTACAGCATGAAACAAAATTCCGCTGTGGTATTCATTGGAATTTTCCTTGTTATCCCCGCTGTCATCCAAAGCTACATTACCACCGGGGCTTTTGAGGTGATGCTAGATGGCGTAGTCGTCTATTCCAAACTCGCTACTGGCCGAATGCCTAATGGCAATGACATACTGAAACCCCTCGTACAAGCGGGTCTCAGAGACGTGAAGTAG 
Protein Sequence
TLQVLFCTSUGMSRNFHQLKEFLEQHFPELANGAIKGANYPAPAWATIASQAIMFMQVFTMMAVFTGDAFWNYIPFVQGAPSWYYSMKQNSAVVFIGIFLVIPAVIQSYITTGAFEVMLDGVVVYSKLATGRMPNGNDILKPLVQAGLRDVK* 
SECIS Sequence
 

Structure Picture