Ni.hy-SELENOH-1-U

General Information

Protein ID
337 
External ID
 

Protein Information

Protein Name
Ni.hy-SELENOH-1-U 
Family
SELENOH 
Species
Nitella hyalina 
Genome
 
EST
gi|372575849|gb|HO517342.1|HO517342 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGGCTAAGAAAAGAATGATCATCGAAGCTTGTAAATCGTGAGGTGCATTCAAGACTCGGGCCGCGAAGTTGGAGAAGATCCTTCTTGGAGCTCTCCCCGACCTGAGTGTGTCCATTAACCCTGATAAGCCCAGAAAGGGCTGTTTCGAGGTCAGAGATGAAGAAGGAAATATATTCGTCTCTCTCCTAAACATGCCAAGACCTTTTTCAGAAGTTGAAGGCCTTAGATTTGGAAGTCCTCTCTCAAGAGATCGTTGCCGGGTTAGCTCCGCCAAAAGCTCCGTCAAAAGCCTCGAAGGCGATGGAGAAGGAAGACGACGGTAA 
Protein Sequence
MAKKRMIIEACKSUGAFKTRAAKLEKILLGALPDLSVSINPDKPRKGCFEVRDEEGNIFVSLLNMPRPFSEVEGLRFGSPLSRDRCRVSSAKSSVKSLEGDGEGRRR* 
SECIS Sequence
ACGUGUUCCUUGGCUAUGGCGAAUUGGGUUUAUGAUCGGCUACAGAUAAACGCAGAGAUGCGACCUGUGGUUGUGACUCGAAAUGUGCUGUGUUUGAAGC 

Structure Picture