Ec.si-SELENOT-1-U

General Information

Protein ID
316 
External ID
 

Protein Information

Protein Name
Ec.si-SELENOT-1-U 
Family
SELENOT 
Species
Ectocarpus siliculosus 
Genome
FN649727 
EST
gi|241961010|gb|FP254465.1|FP254465,gi|242179416|gb|FP278442.1|FP278442,gi|242181315|gb|FP266763.1|FP266763,gi|242159906|gb|FP290302.1|FP290302,gi|241962829|gb|FP255176.1|FP255176,gi|242180591|gb|FP245639.1|FP245639,gi|242158974|gb|FP296739.1|FP296739 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGGGCGGATCCACCAAAAACACAGGCGGGGGGAGCCTCGGCAGCAGCAATAGAGACGATGCACGATCGGCGGCGCAGCAGCTCGCCGTGGCAGATTCCTCCGTAGAGTTTGGCGGCACTGCGAGTTTAGGCGCCGTTACCGGCGCTGGTGCTGTTGGTAGTGGTGGCGACGTGCCGCAAGTGCTGGTCCAATTTTGCGTGTCATGAGGCATGCGGAGGAACTTCGAAGAGCTTCGATCGTTCCTCCACGCACACTACCCCGCTCTCGCCAAGGCGCAGAGCATCCGGGGGGAGCTTTACCCCCCTCCCCCCATGGCCCAAGCCCTGGCCACCCTCGGTTCCTACGCGCAGGTGGGCGGCGTGGCTTCGGTCCTGTTCGGTTCCCTCATCTTCGACAGGCTCGGGGTCCCGGCGCCGTTCTTCGTACCGGTGATGCGGCGCAATCCGATGGCAACGATAGTGGGGCTTACCGTAGCGAACTCGTTCTGCGGCTCCCTTTTGGCGACCGGCGCCTTCGAGGTGTCCATCGACGGGGAACTGGTGTTCTCGCGGCTG 
Protein Sequence
MGGSTKNTGGGSLGSSNRDDARSAAQQLAVADSSVEFGGTASLGAVTGAGAVGSGGDVPQVLVQFCVSUGMRRNFEELRSFLHAHYPALAKAQSIRGELYPPPPMAQALATLGSYAQVGGVASVLFGSLIFDRLGVPAPFFVPVMRRNPMATIVGLTVANSFCGSLLATGAFEVSIDGELVFSRL 
SECIS Sequence
LAVADSSVEFGGTASLGAVTGAGAVGSGGDVPQVLVQFCVSUGMRRNFEELRSFLHAHYPALAKAQSIRGELYPPPPMAQALATLGSYAQVGGVASVLFGSLIFDRLGVPAPFFVPVMRRNPMATIVGLTVANSFCGSLLATGAFEVSIDGELVFSRL 

Structure Picture